{"product_id":"proteintech-85130-5-rr","title":"Proteintech, 85130-5-RR, ASCC3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ASCC3 (85130-5-RR) by Proteintech is a Recombinant antibody targeting ASCC3 in WB, ELISA applications with reactivity to human, mouse samples\n85130-5-RR targets ASCC3 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nASCC3 (Activating Signal Cointegrator 1 Complex Subunit 3) is a multifunctional protein involved in various cellular processes, including transcriptional regulation, DNA repair, and ribosome quality control. It is a member of the ASCC (Activating Signal Cointegrator 1 Complex) family, which functions as a bridge between co-repressors and co-activators in transcriptional regulation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag11848 Product name: Recombinant human ASCC3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-111 aa of BC050681 Sequence: MALPRLTGALRSFSNVTKQDNYNEEVADLKIKRSKLHEQVLDLGLTWKKIIKFLNEKLEKSKMQSINEDLKDILHAAKQIEVNCPFQKRRLDGKEEDEKMSRASDRFRGLR Predict reactive species\nFull Name: activating signal cointegrator 1 complex subunit 3\nCalculated Molecular Weight: 111 aa, 13 kDa, 251 kDa\nObserved Molecular Weight: 245 kDa\nGenBank Accession Number: BC050681\nGene Symbol: ASCC3\nGene ID (NCBI): 10973\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8N3C0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888708800681,"sku":"85130-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85130-5-rr","provider":"Iright","version":"1.0","type":"link"}