{"product_id":"proteintech-85133-3-rr","title":"Proteintech, 85133-3-RR, Kv4.2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Kv4\n85133-3-RR targets Kv4.2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, DU 145 cells,  A549 cells\nPositive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:2000-1:8000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVoltage-gated potassium or Kv channels, specifically those mediating low threshold, rapidly inactivating Ito and IA currents, are known to regulate cardiac and neuronal membrane excitability, respectively (PMID: 12829703). Voltage-gated potassium channel subunit Kv4.2, encoded by the KCND2 gene, belongs to the potassium channel family and D (Shal) subfamily. It is a pore-forming alpha subunit of voltage-gated rapidly inactivating A-type potassium channels. Kv4.2 is highly expressed in the brain (PMID: 10551270). It is a major constituent of A-type potassium currents and a key regulator of neuronal membrane excitability (PMID: 22539834).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag15879 Product name: Recombinant human KCND2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 435-630 aa of BC110449 Sequence: AAKSGSANAYMQSKRNGLLSNQLQSSEDEQAFVSKSGSSFETQHHHLLHCLEKTTNHEFVDEQVFEESCMEVATVNRPSSHSPSLSSQQGVTSTCCSRRHKKTFRIPNANVSGSHQGSIQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISIPTPPVTTPEGDDRPESPEYSGGNIVRVSAL Predict reactive species\nFull Name: potassium voltage-gated channel, Shal-related subfamily, member 2\nCalculated Molecular Weight: 630 aa, 71 kDa\nObserved Molecular Weight: 75 kDa\nGenBank Accession Number: BC110449\nGene Symbol: KCND2\nGene ID (NCBI): 3751\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9NZV8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888356839593,"sku":"85133-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85133-3-rr","provider":"Iright","version":"1.0","type":"link"}