{"product_id":"proteintech-85147-3-rr","title":"Proteintech, 85147-3-RR, C1orf77 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe C1orf77 (85147-3-RR) by Proteintech is a Recombinant antibody targeting C1orf77 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n85147-3-RR targets C1orf77 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells,  HEK-293T cells,  THP-1 cells\nPositive IHC detected in: human colon cancer tissue, human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: SH-SY5Y cells, HeLa cells,  A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag26580 Product name: Recombinant human C1orf77 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC002733 Sequence: MSLRGQNLLRGGRAVAPRMGLRRGGVRGRGGPGRGGLGRGAMGRGGIGGRGRGMIGRGRGGFGGRGRGRGRGRGALARPVLTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPETND Predict reactive species\nFull Name: chromosome 1 open reading frame 77\nCalculated Molecular Weight: 248 aa, 26 kDa\nObserved Molecular Weight: 26-30 kDa\nGenBank Accession Number: BC002733\nGene Symbol: C1orf77\nGene ID (NCBI): 26097\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9Y3Y2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888713879721,"sku":"85147-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85147-3-rr","provider":"Iright","version":"1.0","type":"link"}