{"product_id":"proteintech-85162-4-rr","title":"Proteintech, 85162-4-RR, CDS2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CDS2 (85162-4-RR) by Proteintech is a Recombinant antibody targeting CDS2 in WB, IHC, ELISA applications with reactivity to human samples\n85162-4-RR targets CDS2 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, A549 cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:400\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag29228 Product name: Recombinant human CDS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-65 aa of BC025751 Sequence: MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALSNLSSR Predict reactive species\nFull Name: CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2\nCalculated Molecular Weight: 445 aa, 51 kDa\nObserved Molecular Weight: 50-51 kDa\nGenBank Accession Number: BC025751\nGene Symbol: CDS2\nGene ID (NCBI): 8760\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O95674\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888725119145,"sku":"85162-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85162-4-rr","provider":"Iright","version":"1.0","type":"link"}