{"product_id":"proteintech-85167-1-rr","title":"Proteintech, 85167-1-RR, PARL Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe PARL (85167-1-RR) by Proteintech is a Recombinant antibody targeting PARL in WB, ELISA applications with reactivity to human samples\n85167-1-RR targets PARL in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPARL (Presenilin associated rhomboid like), is a member of the rhomboid family of intramembrane serine proteases that is localized to the inner mitochondrial membrane. PARL has 2 isoforms produced by alternative splicing with the molecular mass of 42 kDa and 37 kDa. PARL regulates mitochondrial remodeling and apoptosis through regulated substrate proteolysis. Proteolytic processing of PARL may result in the release of a small peptide, P-beta, which may transit to the nucleus. The self-regulated cleavage of PARL at positions 52-53 (α-site) and 77--78 (β-site) produce two cleaved forms of PARL named MAMP and PACT with the molecular mass of 36 kDa and 33 kDa respectively (PMID: 14732705, 28178523).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag24789 Product name: Recombinant human PARL protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 56-167 aa of BC014058 Sequence: APRKVEPRRSDPGTSGEAYKRSALIPPVEETVFYPSPYPIRSLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQKEGDFRKEINKWWNNLSDGQR Predict reactive species\nFull Name: presenilin associated, rhomboid-like\nCalculated Molecular Weight: 42 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC014058\nGene Symbol: PARL\nGene ID (NCBI): 55486\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9H300\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888682487977,"sku":"85167-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85167-1-rr","provider":"Iright","version":"1.0","type":"link"}