{"product_id":"proteintech-85333-1-rr","title":"Proteintech, 85333-1-RR, GRIA1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe GRIA1 (85333-1-RR) by Proteintech is a Recombinant antibody targeting GRIA1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat, pig samples\n85333-1-RR targets GRIA1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat cerebellum tissue, mouse brain tissue,  rat brain tissue,  pig brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGlutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes with multiple subunits, each possessing transmembrane regions, and all arranged to form a ligand-gated ion channel. The classification of glutamate receptors is based on their activation by different pharmacologic agonists. This gene belongs to a family of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate (AMPA) receptors.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag21502 Product name: Recombinant human GRIA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 125-249 aa of BC111734 Sequence: LRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTTTEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGAN Predict reactive species\nFull Name: glutamate receptor, ionotropic, AMPA 1\nCalculated Molecular Weight: 906 aa, 102 kDa\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: BC111734\nGene Symbol: GRIA1\nGene ID (NCBI): 2890\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P42261\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888758345897,"sku":"85333-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85333-1-rr","provider":"Iright","version":"1.0","type":"link"}