{"product_id":"proteintech-85348-1-rr","title":"Proteintech, 85348-1-RR, RPL5 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe RPL5 (85348-1-RR) by Proteintech is a Recombinant antibody targeting RPL5 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, monkey samples\n85348-1-RR targets RPL5 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, monkey samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells, 3T3-L1 cells,  A431 cells,  HeLa cells,  Jurkat cells,  MOLT-4 cells,  COS-7 cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRPL5 (Ribosomal Protein L5) is a crucial component of the 60S ribosomal subunit, playing a significant role in ribosome biogenesis and function. It is required for rRNA maturation and the formation of the 60S ribosomal subunits. Defects or mutations in RPL5 are associated with Diamond-Blackfan anemia (DBA), a congenital disorder characterized by red blood cell aplasia.(PMID: 28376382)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag30837 Product name: Recombinant human RPL5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 178-297 aa of BC109370 Sequence: KRFPGYDSESKEFNAEVHRKHIMGQNVADYMRCLMEEDEDAYKKQFSQYIKNSVTPDMMEEMYKKAHAAIRENPVYEKKPKKEVKKKRWNRPKMSLAQKKDRVAQKKASFLRAQERAAES Predict reactive species\nFull Name: ribosomal protein L5\nObserved Molecular Weight: 34 kDa\nGenBank Accession Number: BC109370\nGene Symbol: RPL5\nGene ID (NCBI): 6125\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P46777\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888816705705,"sku":"85348-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85348-1-rr","provider":"Iright","version":"1.0","type":"link"}