{"product_id":"proteintech-85357-1-rr","title":"Proteintech, 85357-1-RR, C9orf89 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe C9orf89 (85357-1-RR) by Proteintech is a Recombinant antibody targeting C9orf89 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n85357-1-RR targets C9orf89 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A549 cells,  C2C12 cells,  H9C2 cells,  rat kidney tissue,  mouse kidney tissue,  human placenta tissue\nPositive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC9orf89 (also known as CARD19 or BinCARD) is a mitochondria-localized protein that inhibits BCL10-induced NF-κB activation mainly through its caspase recruitment structural domain (CARD). It plays a role in T cell receptor (TCR) signaling, but deletion of endogenous CARD19 has a lesser effect on Bcl10-dependent NF-κB activation. In addition, C9orf89 is expressed in multiple cell types and is involved in the regulation of inflammatory and immune responses.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag14084 Product name: Recombinant human C9orf89 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-183 aa of BC004500 Sequence: MTDQTYCDRLVQDTPFLTGHGRLSEQQVDRIILQLNRYYPQILTNKEAEKFRNPKASLRVRLCDLLSHLQRSGERDCQEFYRALYIHAQPLHSRLPSRHALQNSDCTELDSGSQSGELSNRGPMSFLAGLGLAVGLALLLYCYPPDPKGLPGTRRVLGFSPVIIDRHVSRYLLAFLADDLGGL Predict reactive species\nFull Name: chromosome 9 open reading frame 89\nCalculated Molecular Weight: 228 aa, 26 kDa\nObserved Molecular Weight: 15-21 kDa\nGenBank Accession Number: BC004500\nGene Symbol: C9orf89\nGene ID (NCBI): 84270\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q96LW7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888714698921,"sku":"85357-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85357-1-rr","provider":"Iright","version":"1.0","type":"link"}