{"product_id":"proteintech-85383-1-rr","title":"Proteintech, 85383-1-RR, ZIP7 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ZIP7 (85383-1-RR) by Proteintech is a Recombinant antibody targeting ZIP7 in WB, IHC, ELISA applications with reactivity to human samples\n85383-1-RR targets ZIP7 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, HeLa cells,  A549 cells,  K-562 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZIP7, also known as SLC39A7, is a member of the SLC39 family of zinc transporters. It is a transmembrane protein primarily localized to the endoplasmic reticulum (ER) and is involved in the transport of zinc ions from the ER and Golgi apparatus to the cytoplasm. This process is crucial for maintaining zinc homeostasis within the cell and regulating various signaling pathways.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag13798 Product name: Recombinant human SLC39A7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 237-384 aa of BC000645 Sequence: VRHVKGGHGHSHGHGHAHSHTRGSHGHGRQERSTKEKQSSEEEEKETRGVQKRRGGSTVPKDGPVRPQNAEEEKRGLDLRVSGYLNLAADLAHNFTDGLAIGASFRGGRGLGILTTMTVLLHEVPHEVGDFAILVQSGCSKKQAMRLQ Predict reactive species\nFull Name: solute carrier family 39 (zinc transporter), member 7\nCalculated Molecular Weight: 469 aa, 50 kDa\nObserved Molecular Weight: 45-50 kDa, 56 kDa\nGenBank Accession Number: BC000645\nGene Symbol: ZIP7\nGene ID (NCBI): 7922\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q92504\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888844492969,"sku":"85383-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85383-1-rr","provider":"Iright","version":"1.0","type":"link"}