{"product_id":"proteintech-85430-4-rr","title":"Proteintech, 85430-4-RR, BRCC3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe BRCC3 (85430-4-RR) by Proteintech is a Recombinant antibody targeting BRCC3 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n85430-4-RR targets BRCC3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SK-BR-3 cells, HeLa cells,  HEK-293T cells,  MCF-7 cells,  HT-29 cells,  Neuro-2a cells,  HSC-T6 cells\nPositive IP detected in: SK-BR-3 cells\nPositive IHC detected in: human ovary cancer tissue, Human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBRCA1-BRCA2-containing complex subunit 3 (BRCC3), a Lys-63-specific deubiquitinase, is a member of the JAMM\/MPN family of zinc metalloproteases. BRCC3 have been shown to promote the inflammasome activation by deubiquitinating NOD-like receptor containing pyrin domain 3 (NLRP3). BRCC3 is associated with G2\/M arrest in breast cancer cells and DNA damage. The expression of BRCC3 is associated with increased cell proliferation. (PMID: 23246432, PMID: 30272359)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag7584 Product name: Recombinant human BRCC3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 14-316 aa of BC002999 Sequence: LESDAFLVCLNHALSTEKEEVMGLCIGELNDDTRSDSKFAYTGTEMRTVAEKVDAVRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHITVWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQKSSESLHGPRDFWSSSQHISIEGQKEEERYERIEIPIHIVPHVTIGKVCLESAVELPKILCQEEQDAYRRIHSLTHLDSVTKIHNGSVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHLQELQQEKEELMQELSSLE Predict reactive species\nFull Name: BRCA1\/BRCA2-containing complex, subunit 3\nCalculated Molecular Weight: 36 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC002999\nGene Symbol: BRCC3\nGene ID (NCBI): 79184\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P46736\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888591425705,"sku":"85430-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85430-4-rr","provider":"Iright","version":"1.0","type":"link"}