{"product_id":"proteintech-85446-2-rr","title":"Proteintech, 85446-2-RR, HPGDS Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe HPGDS (85446-2-RR) by Proteintech is a Recombinant antibody targeting HPGDS in WB, ELISA applications with reactivity to human samples\n85446-2-RR targets HPGDS in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHematopoietic PGD synthase (HPGDS), one of the PGD2 synthases, is distributed in the cytoplasm of mast cells and Th2 cells and catalyzes PGD2 production during inflammation and allergic reactions. HPGDS belongs to the gene family of σ-type glutathione S-transferase (GST). Like other GSTs, it exists as a homodimer in vivo with a molecular weight of approximately 52 kDa (PMID: 38339125).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag18290 Product name: Recombinant human PGDS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-199 aa of BC020734 Sequence: MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL Predict reactive species\nFull Name: prostaglandin D2 synthase, hematopoietic\nCalculated Molecular Weight: 199 aa, 23 kDa\nObserved Molecular Weight: 26 kDa, 52 kDa\nGenBank Accession Number: BC020734\nGene Symbol: HPGDS\nGene ID (NCBI): 27306\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O60760\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888763523241,"sku":"85446-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85446-2-rr","provider":"Iright","version":"1.0","type":"link"}