{"product_id":"proteintech-85594-5-rr","title":"Proteintech, 85594-5-RR, PMP2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe PMP2 (85594-5-RR) by Proteintech is a Recombinant antibody targeting PMP2 in WB, ELISA applications with reactivity to human, mouse, pig samples\n85594-5-RR targets PMP2 in WB, ELISA applications and shows reactivity with human, mouse, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: fetal human brain tissue, mouse testis tissue,  pig spinal cord tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPMP2 (peripheral myelin protein-2, also known as P2) is one of the major proteins of peripheral myelin and appears to be related to the transport of fatty acids or the metabolism of myelin lipids.P2 constitutes up to 15% of total protein of peripheral nervous system (PNS) myelin. It is also present in small amounts in central nervous system (CNS) myelin, being abundant in spinal cord and brain stem myelin. As a structural protein, P2 is thought to stabilize the myelin membranes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag3411 Product name: Recombinant human PMP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-132 aa of BC034997 Sequence: MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV Predict reactive species\nFull Name: peripheral myelin protein 2\nCalculated Molecular Weight: 132 aa, 15 kDa\nObserved Molecular Weight: 15 kDa\nGenBank Accession Number: BC034997\nGene Symbol: PMP2\nGene ID (NCBI): 5375\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P02689\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888808022185,"sku":"85594-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85594-5-rr","provider":"Iright","version":"1.0","type":"link"}