{"product_id":"proteintech-85608-3-rr","title":"Proteintech, 85608-3-RR, NPL Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe NPL (85608-3-RR) by Proteintech is a Recombinant antibody targeting NPL in WB, ELISA applications with reactivity to human, mouse, rat samples\n85608-3-RR targets NPL in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, rat brain tissue,  rat kidney tissue,  mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe N-acetylneuraminate lyase(NPL) from human (hNAL) which consists of 320 amino acids, has a molecular mass of 35.2 kDa and it catalyses the reversible aldol reaction of sialic acid, and has been extensively used in the synthesis of sialic acids and its analogues(PMID:19057931). The enzyme is widely distributed and are present in numerous pro- and eukaryotic cells, in which they are localized only in the cytosol(PMID:12453637). It belongs to the DHDPS family and has 5 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag10137 Product name: Recombinant human NPL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-193 aa of BC058003 Sequence: MAFPKKKLQGLVAATITPMTENGEINFSVIGQYVDYLVKEQGVKNIFVNGTTGEGLSLSVSERRQVAEEWVTKGKDKLDQVIIHVGALSLKESQELAQHAAEIGADGIAVIAPFFLKPWTKDILINFLKEVAAAAPALPFYYYHIPALTGVKIRAEELLDGILDKIPTFQGLKFSDTDLLDFGQCVDQNRQQQ Predict reactive species\nFull Name: N-acetylneuraminate pyruvate lyase (dihydrodipicolinate synthase)\nCalculated Molecular Weight: 27 kDa, 35 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC058003\nGene Symbol: NPL\nGene ID (NCBI): 80896\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9BXD5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888791769257,"sku":"85608-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85608-3-rr","provider":"Iright","version":"1.0","type":"link"}