{"product_id":"proteintech-85626-1-rr","title":"Proteintech, 85626-1-RR, SOCS4 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SOCS4 (85626-1-RR) by Proteintech is a Recombinant antibody targeting SOCS4 in WB, ELISA applications with reactivity to human samples\n85626-1-RR targets SOCS4 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, Jurkat cells,  U-87 MG cells,  HeLa cells,  HEK-293T cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:20000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSOCS4 contains a SH2 domain and a SOCS BOX domain, and belongs to Suppressors of cytokine signaling (SOCS) family. SOCS family members are known to be cytokine-inducible negative regulators of cytokine signaling.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag35370 Product name: Recombinant human SOCS4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-118 aa of BC060790 Sequence: MAENNENISKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESYSDAETVNGIEKTEVSLRNQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSSRHSSGLPS Predict reactive species\nFull Name: suppressor of cytokine signaling 4\nCalculated Molecular Weight: 51 kDa\nObserved Molecular Weight: 51 kDa\nGenBank Accession Number: BC060790\nGene Symbol: SOCS4\nGene ID (NCBI): 122809\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8WXH5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888667775145,"sku":"85626-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85626-1-rr","provider":"Iright","version":"1.0","type":"link"}