{"product_id":"proteintech-85636-2-rr","title":"Proteintech, 85636-2-RR, CDO1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CDO1 (85636-2-RR) by Proteintech is a Recombinant antibody targeting CDO1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n85636-2-RR targets CDO1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat liver tissue, mouse liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCDO1(cysteine dioxygenase type 1) is also named as CDO and belongs to the cysteine dioxygenase family. It is an enzyme that adds molecular oxygen to the sulfur of cysteine, converting the thiol to a sulfinic acid known as cysteinesulfinic acid (3-sulfinoalanine) and CDO1 is one of the most highly regulated metabolic enzymes responding to diet(PMID:19011731). The expression of CDO can significantly decrease the level of intracellular cysteine and this reduction is also associated with a decrease in total glutathione levels(PMID:17327371). Cysteine dioxygenase (CDO) plays a critical role in the regulation of cellular cysteine concentration andmultiple forms of CDO (23 kDa, 25 kDa, and 68 kDa) have been claimed based upon separation and detection using SDS-PAGE\/western blotting(PMID: 14752623).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag3294 Product name: Recombinant human CDO1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC024241 Sequence: MEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSVGLHRVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN Predict reactive species\nFull Name: cysteine dioxygenase, type I\nCalculated Molecular Weight: 200 aa, 23 kDa\nObserved Molecular Weight: 23 kDa\nGenBank Accession Number: BC024241\nGene Symbol: CDO1\nGene ID (NCBI): 1036\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q16878\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888725086377,"sku":"85636-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85636-2-rr","provider":"Iright","version":"1.0","type":"link"}