{"product_id":"proteintech-85649-2-rr","title":"Proteintech, 85649-2-RR, SNRPA1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SNRPA1 (85649-2-RR) by Proteintech is a Recombinant antibody targeting SNRPA1 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n85649-2-RR targets SNRPA1 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, Jurkat cells,  MCF-7 cells,  Raji cells,  HeLa cells,  mouse liver tissue,  rat liver tissue\nPositive IF\/ICC detected in: HepG2 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSmall nuclear ribonucleoprotein polypeptide a-prime(SNRPA1) is part of the U2 snRNP particle, which associated with the branch point of the lariat-shaped intron, in intermediate in the cascade of mRNA precursor splicing event. It may be required for cell division, and helps the A' protein to bind stem loop IV of U2 snRNA. This is a rabbit polyclonal antibody raised against the full length SNRPA1 of human origin.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag10790 Product name: Recombinant human SNRPA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-255 aa of BC022816 Sequence: MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTDDGEEEMEEDTVTNGS Predict reactive species\nFull Name: small nuclear ribonucleoprotein polypeptide A'\nCalculated Molecular Weight: 255 aa, 28 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC022816\nGene Symbol: SNRPA1\nGene ID (NCBI): 6627\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P09661\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888824963241,"sku":"85649-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85649-2-rr","provider":"Iright","version":"1.0","type":"link"}