{"product_id":"proteintech-85669-2-rr","title":"Proteintech, 85669-2-RR, SCAMP5 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SCAMP5 (85669-2-RR) by Proteintech is a Recombinant antibody targeting SCAMP5 in WB, ELISA applications with reactivity to human, mouse, rat samples\n85669-2-RR targets SCAMP5 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, 37°C incubated mouse brain tissue,  rat brain tissue,  37°C incubated rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSecretory carrier-associated membrane protein 5 (SCAMP5) belongs to the to the SCAMP family. Secretory carrier membrane proteins (SCAMPs) constitute a group of membrane transport proteins in plants, insects and mammals. The mammalian genome contains five types of SCAMP genes, namely, SCAMP1-SCAMP5. (PMID:36217917, PMID:19234194). SCAMPs participate in the vesicle cycling fusion of vesicles and cell membranes and play roles in regulating exocytosis and endocytosis, activating synaptic function and transmitting nerve signals. Among these proteins, SCAMP5 is highly expressed in the brain and has direct or indirect effects on the function of the central nervous system (PMID:36217917). SCAMP5 regulates membrane transport, controls the exocytosis of synaptic vesicles and is related to secretion carrier and membrane function. In addition, SCAMP5 plays a major role in the normal maintenance of the physiological functions of nerve cells (PMID:36217917, PMID:33663553).  For optimal WB detection of this membrane protein, we recommend to avoid boiling the sample after lysis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag31837 Product name: Recombinant human SCAMP5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 170-235 aa of BC024700 Sequence: SMVHKFYRGSGGSFSKAQEEWTTGAWKNPHVQQAAQNAAMGAAQGAMNQPQTQYSATPNYTYSNEM Predict reactive species\nFull Name: secretory carrier membrane protein 5\nCalculated Molecular Weight: 26 kDa\nObserved Molecular Weight: 26 kDa\nGenBank Accession Number: BC024700\nGene Symbol: SCAMP5\nGene ID (NCBI): 192683\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8TAC9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888819327145,"sku":"85669-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85669-2-rr","provider":"Iright","version":"1.0","type":"link"}