{"product_id":"proteintech-85677-1-rr","title":"Proteintech, 85677-1-RR, CD90 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CD90 (85677-1-RR) by Proteintech is a Recombinant antibody targeting CD90 in WB, ELISA applications with reactivity to mouse, rat samples\n85677-1-RR targets CD90 in WB, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, EL-4 cells,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD90 (Thy-1) is a 25 kDa, GPI-linked membrane glycoprotein that belongs to the immunoglobulin superfamily (PMID: 6177036; 6153212). Originally described as a brain thymus cross-reactive antigen, it is found in large quantities on mouse and rat thymocytes and central nervous system cells (PMID: 83175). CD90 has been postulated to be involved in cellular recognition, adherence, and T-cell activation (PMID: 7683034).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg1380 Product name: Recombinant Mouse CD90\/Thy1 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 20-131 aa of NM_009382.3 Sequence: QKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKSISVYRDKLVKC Predict reactive species\nFull Name: thymus cell antigen 1, theta\nCalculated Molecular Weight: 18kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: NM_009382.3\nGene Symbol: CD90\nGene ID (NCBI): 21838\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P01831\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888724005033,"sku":"85677-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85677-1-rr","provider":"Iright","version":"1.0","type":"link"}