{"product_id":"proteintech-85689-5-rr","title":"Proteintech, 85689-5-RR, Tetranectin Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Tetranectin (85689-5-RR) by Proteintech is a Recombinant antibody targeting Tetranectin in WB, IHC, ELISA applications with reactivity to human samples\n85689-5-RR targets Tetranectin in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human plasma\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC-Type Lectin Domain Family 3 Member B (CLEC3B) is a transmembrane Ca2+-binding protein, locating in cell plasma, extracellular matrix and exosomes. Downregulation of CLEC3B has been reported in various diseases. It was demonstrated in CLEC3B-deficient mice that the absence of CLEC3B impeded the mineralization process in osteogenesis. (PMID: 31477130)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg3063 Product name: Recombinant Human CLEC3B protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 22-202 aa of NM_003278.2 Sequence: EPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV Predict reactive species\nFull Name: C-type lectin domain family 3, member B\nCalculated Molecular Weight: 23 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: NM_003278.2\nGene Symbol: CLEC3B\nGene ID (NCBI): 7123\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P05452\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888830599337,"sku":"85689-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85689-5-rr","provider":"Iright","version":"1.0","type":"link"}