{"product_id":"proteintech-85691-2-rr","title":"Proteintech, 85691-2-RR, DARS2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe DARS2 (85691-2-RR) by Proteintech is a Recombinant antibody targeting DARS2 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n85691-2-RR targets DARS2 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, Jurkat cells,  LNCaP cells,  A549 cells,  HepG2 cells,  NCI-H1299 cells\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDARS2 is also named as AspRS (aspartyl-tRNA synthetase) and belongs to the class-II aminoacyl-tRNA synthetase family. The deduced 645-amino acid protein has a 47-amino acid mitochondrial targeting signal, resulting in a mature protein of 598 amino acids. DARS2 contains conserved residues involved in ATP binding, tRNA binding, and aspartic acid recognition, as well as catalytic site motifs characteristic of amino acid tRNA synthetases. It is a dimeric proteins(PMID:19443655). Rat aspartyl-tRNA synthetase has a N-terminal polypeptide extension of about 40 amino acid residues which can be removed without impairing its catalytic activity(PMID:9030747). This protein has different molecular mass(55 kDa, 50 kDa,66 kDa ) according to the publications(PMID:11306575; 19443655;15299749).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag4809 Product name: Recombinant human DARS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 296-645 aa of BC045173 Sequence: LIEGLLQYSWPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRNTEIGFLQDALSKPHGTVKAICIPEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIMESQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECADLLETRGVVLRDPTLFSFLWVVDFPLFLPKEENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLLKEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDLMSNTPDSVPPEELKPYHIRVSKPTDSKAERAH Predict reactive species\nFull Name: aspartyl-tRNA synthetase 2, mitochondrial\nCalculated Molecular Weight: 645 aa, 74 kDa\nObserved Molecular Weight: 66-74 kDa\nGenBank Accession Number: BC045173\nGene Symbol: DARS2\nGene ID (NCBI): 55157\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q6PI48\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888418738345,"sku":"85691-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85691-2-rr","provider":"Iright","version":"1.0","type":"link"}