{"product_id":"proteintech-85706-1-rr","title":"Proteintech, 85706-1-RR, Carbonic Anhydrase 4\/CA4 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Carbonic Anhydrase 4\/CA4 (85706-1-RR) by Proteintech is a Recombinant antibody targeting Carbonic Anhydrase 4\/CA4 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n85706-1-RR targets Carbonic Anhydrase 4\/CA4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse lung tissue, rat lung tissue\nPositive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCA4(Carbonic anhydrase 4) is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary, chorionic (and certain other) capillaries and of proximal renal tubules. It plays a critical role by maintaining the pH in the outer retina, which is important for the normal function of photoreceptors. This protein belongs to the alpha-carbonic anhydrase family.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag4960 Product name: Recombinant human CA4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 17-284 aa of BC057792 Sequence: ASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKS Predict reactive species\nFull Name: carbonic anhydrase IV\nCalculated Molecular Weight: 35 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC057792\nGene Symbol: CA4\nGene ID (NCBI): 762\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P22748\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888597127337,"sku":"85706-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85706-1-rr","provider":"Iright","version":"1.0","type":"link"}