{"product_id":"proteintech-85712-1-rr","title":"Proteintech, 85712-1-RR, SPATA2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SPATA2 (85712-1-RR) by Proteintech is a Recombinant antibody targeting SPATA2 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse samples\n85712-1-RR targets SPATA2 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MCF-7 cells,  Raji cells,  PC-3 cells,  A549 cells,  mouse testis tissue\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag30773 Product name: Recombinant human SPATA2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 330-520 aa of BC009481 Sequence: STQDDVDLYTDSEPRATYRRQDALRPDVWLLRNDAHSLYHKRSPPAKESALSKCQSCGLSCSSSLCQRCDSLLTCPPASKPSAFPSKASTHDSLAHGASLREKYPGQTQGLDRLPHLHSKSKPSTTPTSRCGFCNRPGATNTCTQCSKVSCDACLSAYHYDPCYKKSELHKFMPNNQLNYKSTQLSHLVYR Predict reactive species\nFull Name: spermatogenesis associated 2\nCalculated Molecular Weight: 58 kDa\nObserved Molecular Weight: 58-60 kDa\nGenBank Accession Number: BC009481\nGene Symbol: SPATA2\nGene ID (NCBI): 9825\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9UM82\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888826175657,"sku":"85712-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85712-1-rr","provider":"Iright","version":"1.0","type":"link"}