{"product_id":"proteintech-85717-1-rr","title":"Proteintech, 85717-1-RR, CYP2C8 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CYP2C8 (85717-1-RR) by Proteintech is a Recombinant antibody targeting CYP2C8 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n85717-1-RR targets CYP2C8 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, rat liver tissue\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCYP2C8(Cytochrome P450 2C8) is also named as CYPIIC8, cytochrome P450 IIC2, cytochrome P450 MP-12, cytochrome P450 MP-20, cytochrome P450 form 1 and S-mephenytoin 4-hydroxylase. It belongs to the cytochrome P450 family. It is a monooxygenase involved in an NADPH-dependent electron transport pathway and a hepatic drug-metabolizing enzymes that oxidizes therapeutic drugs such as cerivastatin and endobiotics such as retinoic acid and arachidonic acid. It has 2 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag9898 Product name: Recombinant human CYP2C8 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 142-490 aa of BC020596 Sequence: EDRVQEEAHCLVEELRKTKASPCDPTFILGCAPCNVICSVVFQKRFDYKDQNFLTLMKRFNENFRILNSPWIQVCNNFPLLIDCFPGTHNKVLKNVALTRSYIREKVKEHQASLDVNNPRDFIDCFLIKMEQEKDNQKSEFNIENLVGTVADLFVAGTETTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGRHRSPCMQDRSHMPYTDAVVHEIQRYSDLVPTGVPHAVTTDTKFRNYLIPKGTTIMALLTSVLHDDKEFPNPNIFDPGHFLDKNGNFKKSDYFMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLPPSYQICFIPV Predict reactive species\nFull Name: cytochrome P450, family 2, subfamily C, polypeptide 8\nCalculated Molecular Weight: 490 aa, 56 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC020596\nGene Symbol: CYP2C8\nGene ID (NCBI): 1558\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P10632\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888609546409,"sku":"85717-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85717-1-rr","provider":"Iright","version":"1.0","type":"link"}