{"product_id":"proteintech-85731-1-rr","title":"Proteintech, 85731-1-RR, NOV\/CCN3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe NOV\/CCN3 (85731-1-RR) by Proteintech is a Recombinant antibody targeting NOV\/CCN3 in WB, ELISA applications with reactivity to human, mouse, rat samples\n85731-1-RR targets NOV\/CCN3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A172 cells, HEK-293T cells,  mouse brain tissue,  HeLa cells,  mouse thymus tissue,  Caco-2 cells,  rat thymus tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCN family member 3 (CCN3), also known as Nephroblastoma overexpressed (NOV) protein, is a member of the CCN protein family (PMID: 1309586). CCN3 is predominantly expressed in the cytoplasm, nucleus,  and extracellular space. As a subset of extracellular matrix proteins, it can directly bind to the integrin receptor family on the cell surface and participate in signal transduction between  the cell surface and the extracellular matrix structure (PMID: 37378812). CCN3 exhibits anti-proliferative activity in normal cells and most tumor cells (PMID: 17340618). CCN3 co-localizes with connexin 43 (C×43) in the plasma membrane, and these two proteins physically interact to inhibit cell growth (PMID: 15213231). CCN3 can induce myofibroblast differentiation through the Notch pathway (PMID: 12050162). CCN can promote adhesion of endothelial cells, vascular smooth muscle cells, and fibroblasts through heparan sulfate proteoglycans (HSPG) (PMID: 30158025).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2856 Product name: Recombinant Mouse Nov protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 26-354 aa of NM_010930.4 Sequence: SLRCPSRCPPKCPSISPTCAPGVRSVLDGCSCCPVCARQRGESCSEMRPCDQSSGLYCDRSADPNNQTGICMVPEGDNCVFDGVIYRNGEKFEPNCQYFCTCRDGQIGCLPRCQLDVLLPGPDCPAPRKVAVPGECCEKWTCGSDEQGTQGTLGGLALPAYRPEATVGVEVSDSSINCIEQTTEWSACSKSCGMGVSTRVTNRNRQCEMVKQTRLCIVRPCEQEPEEVTDKKGKKCLRTKKSLKAIHLQFENCTSLYTYKPRFCGVCSDGRCCTPHNTKTIQVEFQCLPGEIIKKPVMVIGTCTCYSNCPQNNEAFLQDLELKTSRGEI Predict reactive species\nFull Name: nephroblastoma overexpressed gene\nCalculated Molecular Weight: 39 kDa\nObserved Molecular Weight: 46 kDa\nGenBank Accession Number: NM_010930.4\nGene Symbol: Nov\nGene ID (NCBI): 18133\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q64299\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888791441577,"sku":"85731-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85731-1-rr","provider":"Iright","version":"1.0","type":"link"}