{"product_id":"proteintech-85732-2-rr","title":"Proteintech, 85732-2-RR, A2BP1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe A2BP1 (85732-2-RR) by Proteintech is a Recombinant antibody targeting A2BP1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n85732-2-RR targets A2BP1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nA2BP1, also named as FOX1 and HRNBP1, contains one RRM (RNA recognition motif) domain. A2BP1 recognizes a (U)GCAUG stretch in regulated exons or in flanking introns. The protein binds to the C-terminus of ataxin-2 and may contribute to the restricted pathology of spinocerebellar ataxia type 2 (SCA2). Ataxin-2 is the product of the SCA2 gene which causes familial neurodegenerative diseases. A2BP1 and ataxin-2 are both localized in the trans-Golgi network.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag18527 Product name: Recombinant human A2BP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-128 aa of BC113691 Sequence: MLASQGVLLHPYGVPMIVPAAPYLPGLIQGNQEAAAAPDTMAQPYASAQFAPPQNGIPAEYTAPHPHPAPEYTGQTTVPEHTLNLYPPAQTHSEQSPADTSAQTVSGTATQTDDAAPTDGQPQTQPSE Predict reactive species\nFull Name: ataxin 2-binding protein 1\nCalculated Molecular Weight: 395 aa, 42 kDa\nObserved Molecular Weight: 45-60 kDa\nGenBank Accession Number: BC113691\nGene Symbol: A2BP1\nGene ID (NCBI): 54715\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9NWB1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888686387369,"sku":"85732-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85732-2-rr","provider":"Iright","version":"1.0","type":"link"}