{"product_id":"proteintech-85735-2-rr","title":"Proteintech, 85735-2-RR, RNF181 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe RNF181 (85735-2-RR) by Proteintech is a Recombinant antibody targeting RNF181 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n85735-2-RR targets RNF181 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, A549 cells,  U2OS cells,  HEK-293 cells,  Jurkat cells\nPositive IF\/ICC detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRNF181, also named as HSPC238, is a 153 amino acid protein, which belongs to the RNF181 family. RNF181 is widely expressed, with highest levels in liver and heart and lowest levels in brain and skeletal muscle. RNF181 as a E3 ubiquitin-protein ligase, accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag14233 Product name: Recombinant human RNF181 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-153 aa of BC002803 Sequence: MASYFDEHDCEPSDPEQETRTNMLLELARSLFNRMDFEDLGLVVDWDHHLPPPAAKTVVENLPRTVIRGSQAELKCPVCLLEFEEEETAIEMPCHHLFHSSCILPWLSKTNSCPLCRYELPTDDDTYEEHRRDKARKQQQQHRLENLHGAMYT Predict reactive species\nFull Name: ring finger protein 181\nCalculated Molecular Weight: 153 aa, 18 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC002803\nGene Symbol: RNF181\nGene ID (NCBI): 51255\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9P0P0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888815820969,"sku":"85735-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85735-2-rr","provider":"Iright","version":"1.0","type":"link"}