{"product_id":"proteintech-85759-4-rr","title":"Proteintech, 85759-4-RR, TIPE2\/TNFAIP8L2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe TIPE2\/TNFAIP8L2 (85759-4-RR) by Proteintech is a Recombinant antibody targeting TIPE2\/TNFAIP8L2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n85759-4-RR targets TIPE2\/TNFAIP8L2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: THP-1 cells, HL-60 cells,  RAW 264.7 cells,  mouse spleen tissue,  rat spleen tissue\nPositive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTIPE2 (TNF-α-inducible protein 8-like 2, or TNFAIP8L2), a negative immune regulator, is essential for maintaining immune homeostasis. TIPE2 shares considerable sequence homology with members of the tumor necrosis factor-α-inducible protein 8 (TNFAIP8) family, which are thought to regulate cellular and immune homeostasis. TIPE2 acts as a negative regulator of Toll-like receptor and T-cell receptor function and is preferentially expressed in lymphoid tissues. TIPE2 plays an essential role in a signal transduction pathway that links the inflammatory immune response to specific conditions after cerebral ischemia\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag7964 Product name: Recombinant human TNFAIP8L2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-184 aa of BC063014 Sequence: MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAIKVAVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSHGRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL Predict reactive species\nFull Name: tumor necrosis factor, alpha-induced protein 8-like 2\nCalculated Molecular Weight: 184 aa, 21 kDa\nObserved Molecular Weight: 18 kDa\nGenBank Accession Number: BC063014\nGene Symbol: TIPE2\nGene ID (NCBI): 79626\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q6P589\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888520188073,"sku":"85759-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85759-4-rr","provider":"Iright","version":"1.0","type":"link"}