{"product_id":"proteintech-85769-4-rr","title":"Proteintech, 85769-4-RR, AKT3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe AKT3 (85769-4-RR) by Proteintech is a Recombinant antibody targeting AKT3 in WB, ELISA applications with reactivity to human, mouse, rat samples\n85769-4-RR targets AKT3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells, mouse brain tissue,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAKT3, also named as PKBG, is one of 3 closely related serine\/threonine-protein kinases (AKT1, AKT2 and AKT3) called the AKT kinase, and which regulate many processes including metabolism, proliferation, cell survival, growth and angiogenesis. AKT3 is a key modulator of several tumors like melanoma, glioma and ovarian cancer. Active AKT3 increases progressively during melanoma tumor progression with highest levels present in advanced-stage metastatic melanomas.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag16298 Product name: Recombinant human AKT3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 95-155 aa of BC121154 Sequence: REEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLG Predict reactive species\nFull Name: v-akt murine thymoma viral oncogene homolog 3 (protein kinase B, gamma)\nCalculated Molecular Weight: 465 aa, 54 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: BC121154\nGene Symbol: AKT3\nGene ID (NCBI): 10000\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9Y243\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888537587881,"sku":"85769-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85769-4-rr","provider":"Iright","version":"1.0","type":"link"}