{"product_id":"proteintech-85884-5-rr","title":"Proteintech, 85884-5-RR, RBBP6 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe RBBP6 (85884-5-RR) by Proteintech is a Recombinant antibody targeting RBBP6 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n85884-5-RR targets RBBP6 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: EC109 cells, NIH\/3T3 cells\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRBBP6 (retinoblastoma binding protein 6) is a multifunctional protein that interacts with both p53 and pRb and has been implicated in mRNA processing. It has also been identified as a putative E3 ubiquitin ligase due to the presence of a RING finger domain [PMID:18851979]. RBBP6 contains an N-terminal ubiquitin-like domain and a cysteine-rich RING finger-like domain, through which it promotes the ubiquitination of p53 by Hdm2 in an E4-like manner [PMID:17470788]. It is implicated in a diverse set of cellular functions, including mRNA metabolism, regulation of the cell cycle, tumorigenesis, and development [PMID:12938151,17470788].\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag2484 Product name: Recombinant human RBBP6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC029352 Sequence: MSCVHYKFSSKLNYDTVTFDGLHISLCDLKKQIMGREKLKAADCDLQITNAQTKEEYTDDNALIPKNSSVIVRRIPIGGVKSTSKTYVISRTEPAMATTKAVCKNTISHFFYTLLLPL Predict reactive species\nFull Name: retinoblastoma binding protein 6\nCalculated Molecular Weight: 1792 aa, 200 kDa\nObserved Molecular Weight: 250 kDa\nGenBank Accession Number: BC029352\nGene Symbol: RBBP6\nGene ID (NCBI): 5930\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q7Z6E9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888813559977,"sku":"85884-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85884-5-rr","provider":"Iright","version":"1.0","type":"link"}