{"product_id":"proteintech-85891-1-rr","title":"Proteintech, 85891-1-RR, MYCBP Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe MYCBP (85891-1-RR) by Proteintech is a Recombinant antibody targeting MYCBP in WB, IF\/ICC, ELISA applications with reactivity to human samples\n85891-1-RR targets MYCBP in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A549 cells,  HEK-293 cells,  Jurkat cells\nPositive IF\/ICC detected in: HEK-293T cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMYC binding protein(MYCBP), encoded by MYCBP gene, binds to N-terminal region of MYC, and then MYC can activate E box-dependent transcription. Upon increasing expression of MYC , MYCBP translocates into the nucleus in the S phase of the cell cycle. MYCBP may involve in spermatogenesis, since it's found to be interacted with AKAP84\/149 in the mitochondria in somatic cells and sperm. It highly expressed in heart, placenta, pancreas,skeletal muscle and kidney, but low in lung. This is a rabbit polyclonal antibody raised against full-length MYCBP of human origin.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag2651 Product name: Recombinant human MYCBP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC008686 Sequence: MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE Predict reactive species\nFull Name: c-myc binding protein\nCalculated Molecular Weight: 103 aa, 12 kDa\nObserved Molecular Weight: 12 kDa\nGenBank Accession Number: BC008686\nGene Symbol: MYCBP\nGene ID (NCBI): 26292\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q99417\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888787214505,"sku":"85891-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85891-1-rr","provider":"Iright","version":"1.0","type":"link"}