{"product_id":"proteintech-85917-1-rr","title":"Proteintech, 85917-1-RR, CD37 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CD37 (85917-1-RR) by Proteintech is a Recombinant antibody targeting CD37 in WB, IHC, IF\/ICC, IF-P, ELISA applications with reactivity to mouse, rat samples\n85917-1-RR targets CD37 in WB, IHC, IF\/ICC, IF-P, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse spleen tissue, rat spleen tissue,  A20 cells\nPositive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: rat spleen tissue, mouse spleen tissue\nPositive IF\/ICC detected in: A20 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD37 is a membrane protein of the tetraspanin superfamily which are characterized by the presence of four conserved transmembrane regions. Many of these members are expressed on leukocytes and have been implicated in signal transduction, cell-cell interactions, and cellular activation and development. CD37 plays a role in B-cell function, and may also play a role in T-cell-B-cell interactions (PMID: 10891477).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2729 Product name: Recombinant Mouse CD37 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 112-241 aa of NM_007645.4 Sequence: RVRLERRVQELVLRTIQSYRTNPDETAAEESWDYAQFQLRCCGWQSPRDWNKAQMLKANESEEPFVPCSCYNSTATNDSTVFDKLFFSQLSRLGPRAKLRQTADICALPAKAHIYREGCAQSLQKWLHNN Predict reactive species\nFull Name: CD37 antigen\nCalculated Molecular Weight: 32 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: NM_007645.4\nGene Symbol: Cd37\nGene ID (NCBI): 12493\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q61470\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888721154217,"sku":"85917-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85917-1-rr","provider":"Iright","version":"1.0","type":"link"}