{"product_id":"proteintech-85943-1-rr","title":"Proteintech, 85943-1-RR, EVI2B Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe EVI2B (85943-1-RR) by Proteintech is a Recombinant antibody targeting EVI2B in WB, IF\/ICC, ELISA applications with reactivity to human samples\n85943-1-RR targets EVI2B in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HepG2 cells,  Ramos cells,  THP-1 cells,  HL-60 cells\nPositive IF\/ICC detected in: THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEcotropic viral integration site 2B protein (EVI2B) is a type I transmembrane protein embedded within intron 27b of the neurofibromatosis type 1 (NF1) gene. It is transcribed in the opposite direction to the NF1 gene (PMID: 37584733). EVI2B is a downstream target of CCAAT\/enhancer binding protein alpha (C\/EBPα), which is crucial for myeloid differentiation and the function of hematopoietic progenitors (PMID: 36830696). This protein is highly expressed in mature granulocytes and is involved in the regulation of immune cell maturation (PMID: 28186500).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg3709 Product name: Recombinant Human EVI2B protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 22-202 aa of BC005926 Sequence: KTETITTEKQSQPTLFTSSMSQVLANSQNTTGNPLGQPTQFSDTFSGQSISPAKVTAGQPTPAVYTSSEKPEAHTSAGQPLAYNTKQPTPIANTSSQQAVFTSARQLPSARTSTTQPPKSFVYTFTQQSSSVQIPSRKQITVHNPSTQPTSTVKNSPRSTPGFILDTTSNKQTPQKNNYNS Predict reactive species\nFull Name: ecotropic viral integration site 2B\nCalculated Molecular Weight: 448 aa, 49 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: BC005926\nGene Symbol: EVI2B\nGene ID (NCBI): 2124\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P34910\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888425849001,"sku":"85943-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85943-1-rr","provider":"Iright","version":"1.0","type":"link"}