{"product_id":"proteintech-85951-2-rr","title":"Proteintech, 85951-2-RR, HOXA10 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe HOXA10 (85951-2-RR) by Proteintech is a Recombinant antibody targeting HOXA10 in IF\/ICC, ELISA applications with reactivity to human samples\n85951-2-RR targets HOXA10 in IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: HeLa cells, U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHOXA10, also named as Homeobox protein Hox-A10, is a 410 amino acid protein, which contains 1 homeobox DNA-binding domain and belongs to the Abd-B homeobox family. HOXA10 localizes in the nucleus and can Interacts with SIRT2. HOXA10 as sequence-specific transcription factor, is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. HoxA10 expression increases during the midsecretory phase of the menstrual cycle, which corresponds with increased levels of circulating progesterone.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag24156 Product name: Recombinant human HOXA10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 203-311 aa of BC013971 Sequence: YGTAKGYGSGGGGAQQLGAGPFPAQPPGRGFDLPPALASGSADAARKERALDSPPPPTLACGSGGGSQGDEEAHASSSAAEELSPAPSESSKASPEKDSLGNSKGENAA Predict reactive species\nFull Name: homeobox A10\nCalculated Molecular Weight: 393 aa, 41 kDa\nGenBank Accession Number: BC013971\nGene Symbol: HOXA10\nGene ID (NCBI): 3206\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P31260\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888859369641,"sku":"85951-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85951-2-rr","provider":"Iright","version":"1.0","type":"link"}