{"product_id":"proteintech-86016-1-rr","title":"Proteintech, 86016-1-RR, GIRK2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe GIRK2 (86016-1-RR) by Proteintech is a Recombinant antibody targeting GIRK2 in WB, ELISA applications with reactivity to human, mouse, rat samples\n86016-1-RR targets GIRK2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MG-63 cells, mouse brain tissue,  NIH\/3T3 cells,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGIRK2 (also known as Kir3.2), encoded by KCNJ6 gene, is a member of the G protein-coupled inwardly-rectifying potassium channel (GIRK, Kir3) family of inward rectifier potassium channels. GIRK channels are activated following stimulation of G protein-coupled receptors (PMID: 26422984). They play important roles in regulating cellular excitabilities in the heart and brain (PMID: 31043612). Mutations in KCNJ6 gene are associated with Keppen-Lubinsky Syndrome (PMID: 25620207).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag16344 Product name: Recombinant human KCNJ6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 351-423 aa of BC101547 Sequence: YNSFHETYETSTPSLSAKELAELASRAELPLSWSVSSKLNQHAELETEEEEKNLEEQTERNGDVANLENESKV Predict reactive species\nFull Name: potassium inwardly-rectifying channel, subfamily J, member 6\nCalculated Molecular Weight: 423 aa, 48 kDa\nObserved Molecular Weight: 45-48 kDa\nGenBank Accession Number: BC101547\nGene Symbol: GIRK2\nGene ID (NCBI): 3763\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P48051\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888755691689,"sku":"86016-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-86016-1-rr","provider":"Iright","version":"1.0","type":"link"}