{"product_id":"proteintech-86059-2-rr","title":"Proteintech, 86059-2-RR, LRRC32 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe LRRC32 (86059-2-RR) by Proteintech is a Recombinant antibody targeting LRRC32 in WB, ELISA applications with reactivity to human samples\n86059-2-RR targets LRRC32 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human peripheral blood platelets, HUVEC cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLRRC32, also known as GARP, is a transmembrane protein of 662 amino acids, the extracellular portion of which contains 20 leucine-rich repeats (PMID: 8180135). LRRC32 is a cell surface receptor on regulatory T-lymphocytes (Treg cells), platelets, hepatic stellate cells and certain cancer cells (PMID: 27054568). It has been demonstrated as a Treg-specific activation marker  (PMID: 20137067). LRRC32 is critical for the surface expression of latent TGF-β by binding to the complex and functioning as its cell surface receptor (PMID: 19651619).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag23423 Product name: Recombinant human LRRC32 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 477-662 aa of BC070079 Sequence: PGLEVATGALGGLEASLEVLALQGNGLMVLQVDLPCFICLKRLNLAENRLSHLPAWTQAVSLEVLDLRNNSFSLLPGSAMGGLETSLRRLYLQGNPLSCCGNGWLAAQLHQGRVDVDATQDLICRFSSQEEVSLSHVRPEDCEKGGLKNINLIIILTFILVSAILLTTLAACCCVRRQKFNQQYKA Predict reactive species\nFull Name: leucine rich repeat containing 32\nCalculated Molecular Weight: 72 kDa\nObserved Molecular Weight: 72-80 kDa\nGenBank Accession Number: BC070079\nGene Symbol: LRRC32\nGene ID (NCBI): 2615\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q14392\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888777384105,"sku":"86059-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-86059-2-rr","provider":"Iright","version":"1.0","type":"link"}