{"product_id":"proteintech-86085-1-rr","title":"Proteintech, 86085-1-RR, NKX3-1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe NKX3-1 (86085-1-RR) by Proteintech is a Recombinant antibody targeting NKX3-1 in WB, ELISA applications with reactivity to human samples\n86085-1-RR targets NKX3-1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNKX3-1, also named as NKX3.1 and NKX3A, belongs to the NK-3 homeobox family. It is a transcription factor, which binds preferentially the consensus sequence 5'-TAAGT[AG]-3' and can behave as a transcriptional repressor. NKX3-1 plays an important role in normal prostate development, regulating proliferation of glandular epithelium and in the formation of ducts in prostate. It act as a tumor suppressor controlling prostate carcinogenesis, as shown by the ability to inhibit proliferation and invasion activities of PC-3 prostate cancer cells(PMID:19462257). The calcualted molecular weight of NKX3-1 is 26 kDa, but modified NKX3-1 is about 32-35 kDa. (PMID: 18597829)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag4070 Product name: Recombinant human NKX3-1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-234 aa of BC074864 Sequence: MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDGAQRQGGRTSSQRQRDPEPEPEPEPEGGRSRAGAQNDQLSTGPRAAPEEAETLAETEPERHLGSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELGDLEKHSSLPALKEEAFSRASLVSVYNSYPYYPYLYCVGSWSPAFW Predict reactive species\nFull Name: NK3 homeobox 1\nCalculated Molecular Weight: 234 aa, 26 kDa\nObserved Molecular Weight: 34-38 kDa\nGenBank Accession Number: BC074864\nGene Symbol: NKX3-1\nGene ID (NCBI): 4824\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q99801\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888790589609,"sku":"86085-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-86085-1-rr","provider":"Iright","version":"1.0","type":"link"}