{"product_id":"proteintech-86089-1-rr","title":"Proteintech, 86089-1-RR, GPR17 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe GPR17 (86089-1-RR) by Proteintech is a Recombinant antibody targeting GPR17 in WB, ELISA applications with reactivity to human, mouse, rat samples\n86089-1-RR targets GPR17 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue,  fetal human brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGPR17 is a G protein-coupled receptor (GPCR) that plays a significant role in various physiological processes, particularly in the central nervous system (CNS). GPR17 is considered a modulator of CNS myelination and is involved in reconstructing and repairing demyelinating plaques caused by ongoing inflammatory processes, such as in multiple sclerosis (MS). It is present in nerve cells and precursor oligodendrocyte cells, playing a role in the differentiation and maturation of oligodendrocytes (PMID: 32182666). GPR17 is a multifaceted GPCR with implications in immune regulation, glucose metabolism, neurodegenerative diseases, and potentially in treating anxiety disorders.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag4106 Product name: Recombinant human GPR17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-91 aa of BC031653 Sequence: VPYHVNRSVYVLHYRSHGASCATQRILALANRITSCLTSLNGALDPIMYFFVAEKFRHALCNLLCGKRLKGPPPSFEGKTNESSLSAKSEL Predict reactive species\nFull Name: G protein-coupled receptor 17\nCalculated Molecular Weight: 367 aa, 41 kDa\nObserved Molecular Weight: 48 kDa\nGenBank Accession Number: BC031653\nGene Symbol: GPR17\nGene ID (NCBI): 2840\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q13304\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888640250025,"sku":"86089-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-86089-1-rr","provider":"Iright","version":"1.0","type":"link"}