{"product_id":"proteintech-86098-1-rr","title":"Proteintech, 86098-1-RR, RARG Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe RARG (86098-1-RR) by Proteintech is a Recombinant antibody targeting RARG in WB, ELISA applications with reactivity to human samples\n86098-1-RR targets RARG in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, HeLa cells,  NCCIT cells,  T-47D cells,  A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRetinoic acid receptors (RARs) are nuclear hormone receptors that act as ligand-dependent transcriptional regulators. In their liganded state, RARs activate transcription, whereas in their nonliganded form, they repress transcription of their target genes. RARs have numerous target genes, which have retinoic response elements in their promoter regions (PMID:17574023). RARG is a member of the retinoid acid receptor (RAR) family, along with RARA, which is known to be involved PML\/RARA fusion of acute promyelocytic leukemia, and RARB. and  rearrangement that conferred to leukemic cells acute promyelocytic leukemia-like morphologic and immunophenotypic features (PMID:20935257).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag1991 Product name: Recombinant human RARG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC019098 Sequence: MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMH Predict reactive species\nFull Name: retinoic acid receptor, gamma\nCalculated Molecular Weight: 454 aa, 50 kDa\nObserved Molecular Weight: 50-60kDa\nGenBank Accession Number: BC019098\nGene Symbol: RARG\nGene ID (NCBI): 5916\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P13631\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888813330601,"sku":"86098-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-86098-1-rr","provider":"Iright","version":"1.0","type":"link"}