{"product_id":"proteintech-86131-2-rr","title":"Proteintech, 86131-2-RR, ADSL Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ADSL (86131-2-RR) by Proteintech is a Recombinant antibody targeting ADSL in WB, ELISA applications with reactivity to human, mouse, rat samples\n86131-2-RR targets ADSL in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  Jurkat cells,  HL-60 cells,  Ramos cells,  NIH\/3T3 cells,  C6 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nADSL(adenylosuccinate lyase) is also named as AMPS, ASase, ASL and belongs to the lyase 1 family. It is an enzyme involved in 2 pathways of purine nucleotide metabolism and catalyzes cleavage of succinyl groups to yield fumarate (PMID:18524658). Defects in ADSL are the cause of adenylosuccinase deficiency (ADSL deficiency). In humans, mutations in ADSL lead to an inborn error of metabolism originally characterized by developmental delay, often with autistic features (PMID:20884265). The ADSL enzymatic activity is reduced in lymphocytes and red blood cells of the patient with severe psychomotor retardation (PMID:9545543). It has 2 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag7332 Product name: Recombinant human ADSL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-354 aa of BC000253 Sequence: MAAGGDHGSPDSYRSPLASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQTLGLPITDEQIQEMKSNLENIDFKMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTDLIILRNALDLLLPKLARVISRLADFAKERASLPTLGFTHFQPAQLTTVGKRCCLWIQDLCMDLQNLKRVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEPFEKQQIGSSAMPYKRNPMRSERCCSLARHLMTLVMDPLQTASVQWFERTLDDSANRRICLAEAFLTADTILNT Predict reactive species\nFull Name: adenylosuccinate lyase\nCalculated Molecular Weight: 55 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC000253\nGene Symbol: ADSL\nGene ID (NCBI): 158\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P30566\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888689926313,"sku":"86131-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-86131-2-rr","provider":"Iright","version":"1.0","type":"link"}