{"product_id":"proteintech-86135-1-rr","title":"Proteintech, 86135-1-RR, RRM1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe RRM1 (86135-1-RR) by Proteintech is a Recombinant antibody targeting RRM1 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n86135-1-RR targets RRM1 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A431 cells,  HEK-293 cells,  K-562 cells,  A549 cells\nPositive IF\/ICC detected in: HeLa cells, HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRibonucleoside-diphosphate reductase functions as a heterodimer of a large and a small subunits in deoxyribonucleotide synthesis. RRM1 constitutes to the large subunit (R1) of ribonucleotide reductase, and it can either form heterodimer with small subunit RRM or RRM2B(PMID:16376858). RRM1 provides the precursors necessary for DNA synthesis. RRM1 can not be detected in quiescent cells, while its mRNA and protein are present throughout the cell cycle in cycling cells(PMID:8188248). Researches showed that RRM1 is involved in carcinogenesis, tumor progression, and the resistance of non-small-cell lung cancer (NSCLC) to treatment. Low level expression of RRM1 in NSCLC is associated with poor survival (PMID:17314339).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag0789 Product name: Recombinant human RRM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 593-792 aa of BC006498 Sequence: IRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKERNTAAMVCSLENRDECLMCGS Predict reactive species\nFull Name: ribonucleotide reductase M1\nCalculated Molecular Weight: 90 kDa\nObserved Molecular Weight: 90 kDa\nGenBank Accession Number: BC006498\nGene Symbol: RRM1\nGene ID (NCBI): 6240\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P23921\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888817492137,"sku":"86135-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-86135-1-rr","provider":"Iright","version":"1.0","type":"link"}