{"product_id":"proteintech-86163-1-rr","title":"Proteintech, 86163-1-RR, SLC25A22 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SLC25A22 (86163-1-RR) by Proteintech is a Recombinant antibody targeting SLC25A22 in WB, IF-P, ELISA applications with reactivity to human samples\n86163-1-RR targets SLC25A22 in WB, IF-P, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  HT-29 cells\nPositive IF-P detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)-P: IF-P : 1:125-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC25A22 encodes a mitochondrial glutamate\/H+ symporter with highly expression in brain, especially in astrocytes, where it controls glutamate uptake. The mutations of SLC25A22 are associated with the early\/infantile epileptic encephalopathies. It has been shown that SLC25A22 plays a key role in promoting proliferation and migration in cancer, such as human colorectal cancer (CRC) and Gallbladder cancer (GBC). And there is a result that the expression of SLC25A22 in GBC was significantly higher than that in adjacent tissues. 25402-1-AP antibody is specific to SLC25A22.(PMID: 30814911, 25033742, 24596948)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag19958 Product name: Recombinant human SLC25A22 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 128-188 aa of BC023545 Sequence: KIQLQDAGRIAAQRKILAAQGQLSAQGGAQPSVEAPAAPRPTATQLTRDLLRSRGIAGLYK Predict reactive species\nFull Name: solute carrier family 25 (mitochondrial carrier: glutamate), member 22\nCalculated Molecular Weight: 323 aa, 34 kDa\nObserved Molecular Weight: 30-34 kDa\nGenBank Accession Number: BC023545\nGene Symbol: SLC25A22\nGene ID (NCBI): 79751\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9H936\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888822669481,"sku":"86163-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-86163-1-rr","provider":"Iright","version":"1.0","type":"link"}