{"product_id":"proteintech-86188-1-rr","title":"Proteintech, 86188-1-RR, MARVELD2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe MARVELD2 (86188-1-RR) by Proteintech is a Recombinant antibody targeting MARVELD2 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n86188-1-RR targets MARVELD2 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MCF-7 cells\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMARVELD2, also named as Tricellulin or TRIC, is a 558 amino acid protein, which contains one MARVEL domain. MARVELD2 localizes the cell membrane and plays a role in the formation of the epithelial barriers. MARVELD2, is a first integral membrane protein that is concentrated at the vertically oriented tight junction strands of tricellular contacts. MARVELD2 may be a component to maintain the integrity for peripheral nervous system myelin function and morphology.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag4446 Product name: Recombinant human MARVELD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 365-558 aa of BC033689 Sequence: LWRHEAARRHREYMEQQEINEPSLSSKRKMCEMATSGDRQRDSEVNFKELRTAKMKPELLSGHIPPGHIPKPIVMPDYVAKYPVIQTDDERERYKAVFQDQFSEYKELSAEVQAVLRKFDELDAVMSRLPHHSESRQEHERISRIHEEFKKKKNDPTFLEKKERCDYLKNKLSHIKQRIQEYDKVMNWDVQGYS Predict reactive species\nFull Name: MARVEL domain containing 2\nCalculated Molecular Weight: 558 aa, 64 kDa\nObserved Molecular Weight: 60-64 kDa\nGenBank Accession Number: BC033689\nGene Symbol: MARVELD2\nGene ID (NCBI): 153562\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8N4S9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888780562601,"sku":"86188-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-86188-1-rr","provider":"Iright","version":"1.0","type":"link"}