{"product_id":"proteintech-86202-1-rr","title":"Proteintech, 86202-1-RR, MCOLN3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe MCOLN3 (86202-1-RR) by Proteintech is a Recombinant antibody targeting MCOLN3 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n86202-1-RR targets MCOLN3 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells, HeLa cells,  SH-SY5Y cells\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMCOLN3 (Mucolipin 3) is a member of the TRPML (Transient Receptor Potential Mucolipin) gene family and encodes a non-selective cation channel protein that is primarily localized on the membranes of endosomes and lysosomes. MCOLN3 promotes endosome acidification, regulates membrane transport and fusion, and is involved in the autophagy process. Additionally, MCOLN3 is involved in the regulation of intracellular calcium (Ca²⁺) and iron (Fe²⁺) ion homeostasis, maintains lysosomal membrane potential, promotes endosome-lysosome fusion and material transport (such as autophagy), and may also be involved in neuronal signaling and immune regulation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag4962 Product name: Recombinant human MCOLN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 86-285 aa of BC060765 Sequence: MVVAFKEENTIAFKHLFLKGYMDRMDDTYAVYTQSDVYDQLIFAVNQYLQLYNVSVGNHAYENKGTKQSAMAICQHLYKRGNIYPGNDTFDIDPEIETECFFVEPDEPFHIGTPAENKLNLTLDFHRLLTVELQFKLKAINLQTVRHQELPDCYDFTLTITFDNKAHSGRIKISLDNDISIRECKDWHVSGSIQKNTHYM Predict reactive species\nFull Name: mucolipin 3\nCalculated Molecular Weight: 64 kDa\nObserved Molecular Weight: 80 kDa\nGenBank Accession Number: BC060765\nGene Symbol: MCOLN3\nGene ID (NCBI): 55283\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8TDD5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888781807785,"sku":"86202-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-86202-1-rr","provider":"Iright","version":"1.0","type":"link"}