{"product_id":"proteintech-86207-1-rr","title":"Proteintech, 86207-1-RR, DKK1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe DKK1 (86207-1-RR) by Proteintech is a Recombinant antibody targeting DKK1 in WB, ELISA applications with reactivity to mouse, rat samples\n86207-1-RR targets DKK1 in WB, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Neuro-2a cells, mouse brain tissue,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDKK1, also named a SK and Dickkopf-1, belongs to the dickkopf family. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease. SDS-PAGE and Western blot analysis demonstrated that DKK1 is expressed as a 35-kDa doublet protein, which is larger than the deduced molecular mass of 26 kDa. Sometime DKK1 is expressed as a 42- to 50-kDa secreted protein, with little change observed after glycanase treatment.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg4649 Product name: Recombinant Mouse DKK1 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 32-272 aa of NM_010051.3 Sequence: TLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGSDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHFPRGEIEESIIENLGNDHNAAAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCAAGLCCARHFWSKICKPVLKEGQVCTKHKRKGSHGLEIFQRCYCGEGLACRIQKDHHQASNSSRLHTCQRH Predict reactive species\nFull Name: dickkopf homolog 1 (Xenopus laevis)\nCalculated Molecular Weight: 29kDa\nObserved Molecular Weight: 30-35 kDa\nGenBank Accession Number: NM_010051.3\nGene Symbol: Dkk1\nGene ID (NCBI): 13380\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O54908\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888736456873,"sku":"86207-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-86207-1-rr","provider":"Iright","version":"1.0","type":"link"}