{"product_id":"proteintech-86226-3-rr","title":"Proteintech, 86226-3-RR, TORC1\/CRTC1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe TORC1\/CRTC1 (86226-3-RR) by Proteintech is a Recombinant antibody targeting TORC1\/CRTC1 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n86226-3-RR targets TORC1\/CRTC1 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, Jurkat cells,  L02 cells,  HeLa cells\nPositive IF\/ICC detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCRTC1, also named as MECT1,TORC1, and WAMTP1, belongs to the TORC family. It is a transcriptional coactivator for CREB1 which activates transcription through both consensus and variant cAMP response element (CRE) sites. CRTC1 acts as a coactivator, in the SIK\/TORC signaling pathway, being active when dephosphorylated and acts independently of CREB1 'Ser-133' phosphorylation. It enhances the interaction of CREB1 with TAF4. CRTC1 regulates the expression of specific CREB-activated genes such as the steroidogenic gene, StAR. It is a potent coactivator of PGC1alpha and inducer of mitochondrial biogenesis in muscle cells. CRTC1 is also a coactivator for TAX activation of the human T-cell leukemia virus type 1 (HTLV-1) long terminal repeats (LTR). In the hippocampus, CRTC1 involved in late-phase long-term potentiation (L-LTP) maintenance at the Schaffer collateral-CA1 synapses. It may be required for dendritic growth of developing cortical neurons. CRTC1 has some isoforms produced by alternative splicing with MW of 67 kDa, 68 kDa and 62 kDa. Sometimes it appears as a 75-80 kDa band probably due to phosphorylation (PMID: 17183642; 22770221)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag0693 Product name: Recombinant human TORC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC028050 Sequence: MATSNNPRKFSEKIALHNQKQAEETAAFEEVMKDLSLTRAARLQLQKSQYLQLGPSRGQYYGGSLPNVNQIGSGTMDLPFQTPFQSSGLDTSRTTRHHGLVDRVYRERGRLGSPHRRPLSVDKHGRQADSCPYGTMYLSPPADTSWRRTNSDSALHQSTMTPTQPESFSSGSQDVHQKRVLLLTVPGMEETTSEADKNLSKQAWDTKKTGSRPKSCEVPGINIFPSADQENTTALIPATHNTGGSLPDLTNIHFPSPLPTPLDPEEPTFPALSSSSSTGNLAANLTHLGIGGAGQGMSTP Predict reactive species\nFull Name: CREB regulated transcription coactivator 1\nCalculated Molecular Weight: 75 kDa\nObserved Molecular Weight: 68-80 kDa\nGenBank Accession Number: BC028050\nGene Symbol: CRTC1\nGene ID (NCBI): 23373\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q6UUV9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888834400425,"sku":"86226-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-86226-3-rr","provider":"Iright","version":"1.0","type":"link"}