{"product_id":"proteintech-86249-1-rr","title":"Proteintech, 86249-1-RR, FKBP1A Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe FKBP1A (86249-1-RR) by Proteintech is a Recombinant antibody targeting FKBP1A in WB, ELISA applications with reactivity to human, mouse, rat samples\n86249-1-RR targets FKBP1A in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse brain tissue,  U-87 MG cells,  PANC-1 cells,  Neuro-2a cells,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFKBP1A(FK506-binding protein 1A) is also named as FKBP1, FKBP12 and belongs to the FKBP-type PPIase family.It keeps in an inactive conformation TGFBR1, the TGF-beta type I serine\/threonine kinase receptor, preventing TGF-beta receptor activation in absence of ligand and catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag0406 Product name: Recombinant human FKBP1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 6-108 aa of BC001925 Sequence: ETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE Predict reactive species\nFull Name: FK506 binding protein 1A, 12kDa\nCalculated Molecular Weight: 12 kDa\nObserved Molecular Weight: 15 kDa\nGenBank Accession Number: BC001925\nGene Symbol: FKBP1A\nGene ID (NCBI): 2280\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P62942\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888752414889,"sku":"86249-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-86249-1-rr","provider":"Iright","version":"1.0","type":"link"}