{"product_id":"proteintech-86344-3-rr","title":"Proteintech, 86344-3-RR, DAZL Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe DAZL (86344-3-RR) by Proteintech is a Recombinant antibody targeting DAZL in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples\n86344-3-RR targets DAZL in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human testis tissue, mouse testis tissue,  rat testis tissue\nPositive IP detected in: mouse testis tissue\nPositive IHC detected in: mouse testis tissue, rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)-P: IF-P : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDAZL proteins are germ cell-specific RNA-binding proteins and are considered major regulators of spermatogenesis. Because DAZL is a novel protein expressed specifically in germ cells, it is widely employed as a germ cell marker. In humans, immunostaining shows DAZL is abundant in the cytoplasm of primary spermatocytes, but scarce in spermatogonia.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag37074 Product name: Recombinant human DAZL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 200-295 aa of BC027595 Sequence: QRSYVVPPAYSAVNYHCNEVDPGAEVVPNECSVHEATPPSGNGPQKKSVDRSIQTVVSCLFNPENRLRNSVVTQDDYFKDKRVHHFRRSRAMLKSV Predict reactive species\nFull Name: deleted in azoospermia-like\nCalculated Molecular Weight: 295 aa, 33 kDa\nObserved Molecular Weight: 37 kDa\nGenBank Accession Number: BC027595\nGene Symbol: DAZL\nGene ID (NCBI): 1618\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q92904\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888418803881,"sku":"86344-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-86344-3-rr","provider":"Iright","version":"1.0","type":"link"}