{"product_id":"proteintech-86354-1-rr","title":"Proteintech, 86354-1-RR, DUSP19 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe DUSP19 (86354-1-RR) by Proteintech is a Recombinant antibody targeting DUSP19 in WB, ELISA applications with reactivity to human, mouse samples\n86354-1-RR targets DUSP19 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U2OS cells, mouse pancreas tissue,  HepG2 cells,  HuH-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDUSP19 (Dual-Specificity Phosphatase 19), also known as SKRP1, LMW-DSP3, or SAPK pathway-regulating phosphatase 1, is a low-molecular-weight member of the dual-specificity phosphatase family.  It is encoded on human chromosome 2q32 and expressed in multiple tissues, with the highest levels found in the pancreas and heart. Structurally, DUSP19 contains a conserved catalytic domain that removes phosphate groups from both phospho-tyrosine and phospho-serine\/threonine residues, enabling it to negatively or positively regulate MAPK signaling.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag3611 Product name: Recombinant human DUSP19 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-217 aa of BC035000 Sequence: MYSLNQEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSSGGGCGYVQDLSSDLQVGVIKPWLLLGSQDAAHDLDTLKKNKVTHILNVAYGVENAFLSDFTYKSISILDLPETNILSYFPECFEFIEEAKRKDGVVLVHCNAGVSRAAAIVIGFLMNSEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESNKCDRIQENSS Predict reactive species\nFull Name: dual specificity phosphatase 19\nCalculated Molecular Weight: 217 aa, 24 kDa\nObserved Molecular Weight: 26 kDa\nGenBank Accession Number: BC035000\nGene Symbol: DUSP19\nGene ID (NCBI): 142679\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8WTR2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888738259113,"sku":"86354-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-86354-1-rr","provider":"Iright","version":"1.0","type":"link"}