{"product_id":"proteintech-86361-2-rr","title":"Proteintech, 86361-2-RR, WDR74 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe WDR74 (86361-2-RR) by Proteintech is a Recombinant antibody targeting WDR74 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n86361-2-RR targets WDR74 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, MDA-MB-231 cells,  A-673 cells,  A375 cells,  IMR-32 cells,  RAW264.7 cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWDR74, also known as WD repeat domain 74, is a protein-coding gene that plays important roles in various biological processes. WDR74 is involved in rRNA processing and ribosomal large subunit biogenesis. It is a 60S ribosome assembly factor, which is irreplaceable in ribosome biogenesis and is closely related to protein synthesis. WDR74 can induce nuclear β-catenin accumulation and activate Wnt-responsive genes, thus promoting cell proliferation and metastasis in various cancers.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag14617 Product name: Recombinant human WDR74 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC006351 Sequence: MAAAAARWNHVWVGTETGILKGVNLQRKQAANFTAGGQPRREEAVSALCWGTGGETQMLVGCADRTVKHFSTEDGIFQGQRHCPGGEGMFRGLAQADGTLITCVDSGILRVWHDKDKDTSSDPLLELRVGPGVCRMRQDPAHPHVVATGGKENALKIWDLQGSEEPVFRAKNVRNDWLDLRVPIWDQDIQFLPGSQKLVTCTGYHQVRVYDPASPQRRPVLETTYGEYPLTAMTLTPGGNSVIVGNTHGQLAEIDLRQGRLLGCLKGLAGSVRGLQCHPSKPLLASCGLDRVLRIHRIQN Predict reactive species\nFull Name: WD repeat domain 74\nCalculated Molecular Weight: 385 aa, 42 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC006351\nGene Symbol: WDR74\nGene ID (NCBI): 54663\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q6RFH5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888523563177,"sku":"86361-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-86361-2-rr","provider":"Iright","version":"1.0","type":"link"}