{"product_id":"proteintech-86369-1-rr","title":"Proteintech, 86369-1-RR, GALM Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe GALM (86369-1-RR) by Proteintech is a Recombinant antibody targeting GALM in WB, ELISA applications with reactivity to human, mouse, rat samples\n86369-1-RR targets GALM in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  SK-N-SH cells,  SH-SY5Y cells,  mouse kidney tissue,  rat kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGALM, also named as Aldose 1-epimerase, belongs to the aldose epimerase family. GALM is a mutarotase that catalyzes the interconversion of beta-D-galactose and alpha-D-galactose during galactose metabolism. GALM is involved in the maintenance of the equilibrium between the beta- and alpha-anomers of galactose, therefore ensuring a sufficient supply of the alpha-anomer for GALK1. GALM is also active on D-glucose, but its preference for galactose is higher than that of glucose. The calculated molecular weight of GALM is 38 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag8842 Product name: Recombinant human GALM protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-342 aa of BC019263 Sequence: MASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEGYPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFNLAGQASPNINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSVA Predict reactive species\nFull Name: galactose mutarotase (aldose 1-epimerase)\nCalculated Molecular Weight: 342 aa, 38 kDa\nObserved Molecular Weight: 38 kDa\nGenBank Accession Number: BC019263\nGene Symbol: GALM\nGene ID (NCBI): 130589\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q96C23\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888754577577,"sku":"86369-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-86369-1-rr","provider":"Iright","version":"1.0","type":"link"}